BNP-32 (human) acetate salt
H-Ser-Pro-Lys-Met-Val-Gln-Gly-Ser-Gly-Cys-Phe-Gly-Arg-Lys-Met-Asp-Arg-Ile-Ser-Ser-Ser-Ser-Gly-Leu-Gly-Cys-Lys-Val-Leu-Arg-Arg-His-OH acetate salt (Disulfide bond)
Catalog # | Pkg Size | Price(USD) | Quantity | Buy this product |
---|---|---|---|---|
R-M-752 | 0.5mg | 405.00 | + Add to cart |
|
R-M-752 | 1mg | 740.00 | + Add to cart |
|
|
Product description
BNP is an important biomarker in the diagnosis of heart diseases. Additionally, BNP-32 may act as a neuropeptide. BNP-32 exerts strong lipolytic effects in humans.The product can only be used for scientific research, not for human body.
Appearance | N/A |
---|---|
Molecular weight | N/A |
Purity | >90% |
Solubility | N/A |
Cas | 124584-08-3 |
Sequence | SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH |
Synonyms | Brain Natriuretic Peptide-32 (human), Nesiritide, BNP (1-32), human |
Molecular Formula | C₁₄₃H₂₄₄N₅₀O₄₂S₄ |
Storage | -20℃, protected from light and moisture |
Transportation | 4-25℃ temperature for up to 3 weeks |
Stability | 1 year |
Document
Related Product